Loading...
Statistics
Advertisement

My Site
www.herepackaging.com/
Check out this GoDaddy hosted webpage! http://herepackaging.com.

Herepackaging.com

Advertisement
Conversion Technology Metas Server
Herepackaging.com is hosted in United States / Scottsdale . Herepackaging.com uses HTTPS protocol. Number of used technologies: 5. First technologies: CSS, Html, Javascript, Number of used javascripts: 4. First javascripts: Jquery.js, Jquery-ui.js, Ss-merged-1.0.0.0.js, Number of used analytics tools: 0. Its server type is: Microsoft-IIS/7.0.

Technologies in use by Herepackaging.com

Technology

Number of occurences: 5
  • CSS
  • Html
  • Javascript
  • jQuery
  • jQuery UI

Advertisement

Javascripts

Number of occurences: 4
  • jquery.js
  • jquery-ui.js
  • ss-merged-1.0.0.0.js
  • cygnus-duel.js

Server Type

  • Microsoft-IIS/7.0

Powered by

  • ASP.NET

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Herepackaging.com

SSL certificate

    • name: /1.3.6.1.4.1.311.60.2.1.3=US/1.3.6.1.4.1.311.60.2.1.2=Delaware/businessCategory=Private Organization/serialNumber=5510922/C=US/ST=Arizona/L=Scottsdale/O=GoDaddy INC./CN=instantpage.me
    • subject:
      • UNDEF:
        • 0: US
        • 1: Delaware
      • businessCategory: Private Organization
      • serialNumber: 5510922
      • C: US
      • ST: Arizona
      • L: Scottsdale
      • O: GoDaddy INC.
      • CN: instantpage.me
    • hash: def2983b
    • issuer:
      • C: US
      • ST: Arizona
      • L: Scottsdale
      • O: GoDaddy.com, Inc.
      • OU: http://certs.godaddy.com/repository/
      • CN: Go Daddy Secure Certificate Authority - G2
    • version: 2
    • serialNumber: 14778005099663976272
    • validFrom: 151019231340Z
    • validTo: 170929203338Z
    • validFrom_time_t: 1445296420
    • validTo_time_t: 1506717218
    • extensions:
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • keyUsage: Digital Signature, Key Encipherment
      • crlDistributionPoints: Full Name: URI:http://crl.godaddy.com/gdig2s3-2.crl
      • certificatePolicies: Policy: 2.16.840.1.114413.1.7.23.3 CPS: http://certificates.godaddy.com/repository/
      • authorityInfoAccess: OCSP - URI:http://ocsp.godaddy.com/ CA Issuers - URI:http://certificates.godaddy.com/repository/gdig2.crt
      • authorityKeyIdentifier: keyid:40:C2:BD:27:8E:CC:34:83:30:A2:33:D7:FB:6C:B3:F0:B4:2C:80:CE
      • subjectAltName: DNS:instantpage.me, DNS:www.instantpage.me, DNS:instant-page.godaddy.com, DNS:admin.instantpage.me
      • subjectKeyIdentifier: 15:36:D2:61:D4:EB:4D:33:9A:DA:5D:59:8B:DE:49:37:98:A0:99:25
      • 1.3.6.1.4.1.11129.2.4.2: ‚jhuVš/×ÂìÓõá½D²>ÇFv¹¼™\ÀUÖ‰ÐÝP‚aàäF0D ,Å»$¦›]Ìb­OtS_é{òÕK«^ƒÊ>5- A¶†æÜjÓuˆ”ôv*ÐÞÀn"[“WO¡&à”óQvhö˜ød‚¾:Œî¹(LüqQ]g“ÔDÑ g¬»OOûÄP‚aãG0E Dï—‰x“WؘÕWLå¢XÐ`«}RG|SH, Rý!­£l3A Ûcǯ¨«Ö “‘¨T‘‚Ó`()qtwæw¤¹ ´X‡»¢Ìgp <5˜ù߸ãwÍÈ ÜP‚aæLH0F!ß5ÿÒ¸D„„¨±¾ZÏ[E AMizU¥2CÜd¿ŠÈ!Üþ`‰u9ˆÍ.ãHEç.öYRq)¬n>‘‹>~T

Meta - Herepackaging.com

Number of occurences: 3
  • Name:
    Content: http://imagesak.websitetonight.com/skins/pl.gd/images/logo1.gif
  • Name: viewport
    Content: width=1024
  • Name: description
    Content: Check out this GoDaddy hosted webpage! http://herepackaging.com.

Server / Hosting

  • IP: 97.74.42.79
  • Latitude: 33.61
  • Longitude: -111.89
  • Country: United States
  • City: Scottsdale

Rname

  • ns11.domaincontrol.com
  • ns12.domaincontrol.com
  • ALT1.ASPMX.L.GOOGLE.com
  • ALT2.ASPMX.L.GOOGLE.com
  • ASPMX.L.GOOGLE.com
  • ASPMX2.GOOGLEMAIL.com
  • ASPMX3.GOOGLEMAIL.com

Target

  • dns.jomax.net

HTTP Header Response

HTTP/1.1 200 OK Cache-Control: private Content-Type: text/html; charset=utf-8 Server: Microsoft-IIS/7.0 X-AspNetMvc-Version: 2.0 X-AspNet-Version: 4.0.30319 X-Powered-By: ASP.NET Date: Tue, 13 Sep 2016 08:10:29 GMT Content-Length: 18593 X-Cache: MISS from s_ub9 Via: 1.1 s_ub9 (squid/3.5.20) Connection: keep-alive

DNS

host: herepackaging.com
  1. class: IN
  2. ttl: 600
  3. type: A
  4. ip: 97.74.42.79
host: herepackaging.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns11.domaincontrol.com
host: herepackaging.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns12.domaincontrol.com
host: herepackaging.com
  1. class: IN
  2. ttl: 3600
  3. type: SOA
  4. mname: ns11.domaincontrol.com
  5. rname: dns.jomax.net
  6. serial: 2016081600
  7. refresh: 28800
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 3600
host: herepackaging.com
  1. class: IN
  2. ttl: 1800
  3. type: MX
  4. pri: 5
  5. target: ALT1.ASPMX.L.GOOGLE.com
host: herepackaging.com
  1. class: IN
  2. ttl: 1800
  3. type: MX
  4. pri: 5
  5. target: ALT2.ASPMX.L.GOOGLE.com
host: herepackaging.com
  1. class: IN
  2. ttl: 1800
  3. type: MX
  4. pri: 1
  5. target: ASPMX.L.GOOGLE.com
host: herepackaging.com
  1. class: IN
  2. ttl: 1800
  3. type: MX
  4. pri: 10
  5. target: ASPMX2.GOOGLEMAIL.com
host: herepackaging.com
  1. class: IN
  2. ttl: 1800
  3. type: MX
  4. pri: 10
  5. target: ASPMX3.GOOGLEMAIL.com
host: herepackaging.com
  1. class: IN
  2. ttl: 3600
  3. type: TXT
  4. txt: google-site-verification=0Y2TGD85yYz3Cf1AXJUpCXtgiEZKG6BPUOGvqz2S7F0
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.erepackaging.com, www.heerepackaging.com, www.eerepackaging.com, www.hderepackaging.com, www.derepackaging.com, www.hcerepackaging.com, www.cerepackaging.com, www.huerepackaging.com, www.uerepackaging.com, www.hjerepackaging.com, www.jerepackaging.com, www.herepackaging.com, www.erepackaging.com, www.hberepackaging.com, www.berepackaging.com, www.hgerepackaging.com, www.gerepackaging.com, www.hrepackaging.com, www.hexrepackaging.com, www.hxrepackaging.com, www.hesrepackaging.com, www.hsrepackaging.com, www.hewrepackaging.com, www.hwrepackaging.com, www.herrepackaging.com, www.hrrepackaging.com, www.hefrepackaging.com, www.hfrepackaging.com, www.hevrepackaging.com, www.hvrepackaging.com, www.hecrepackaging.com, www.hcrepackaging.com, www.heqrepackaging.com, www.hqrepackaging.com, www.hearepackaging.com, www.harepackaging.com, www.heyrepackaging.com, www.hyrepackaging.com, www.heepackaging.com, www.heriepackaging.com, www.heiepackaging.com, www.heroepackaging.com, www.heoepackaging.com, www.herlepackaging.com, www.helepackaging.com, www.herlepackaging.com, www.helepackaging.com, www.her.epackaging.com, www.he.epackaging.com, www.herpackaging.com, www.herexpackaging.com, www.herxpackaging.com, www.herespackaging.com, www.herspackaging.com, www.herewpackaging.com, www.herwpackaging.com, www.hererpackaging.com, www.herrpackaging.com, www.herefpackaging.com, www.herfpackaging.com, www.herevpackaging.com, www.hervpackaging.com, www.herecpackaging.com, www.hercpackaging.com, www.hereqpackaging.com, www.herqpackaging.com, www.hereapackaging.com, www.herapackaging.com, www.hereypackaging.com, www.herypackaging.com, www.hereackaging.com, www.herepiackaging.com, www.hereiackaging.com, www.herepkackaging.com, www.herekackaging.com, www.herepuackaging.com, www.hereuackaging.com, www.herepjackaging.com, www.herejackaging.com, www.hereplackaging.com, www.herelackaging.com, www.herepckaging.com, www.herepaockaging.com, www.herepockaging.com, www.herepapckaging.com, www.hereppckaging.com, www.herepa9ckaging.com, www.herep9ckaging.com, www.herepackaging.com, www.herepckaging.com, www.herepaickaging.com, www.herepickaging.com, www.herepauckaging.com, www.herepuckaging.com, www.herepakaging.com, www.herepacdkaging.com, www.herepadkaging.com, www.herepacrkaging.com, www.hereparkaging.com, www.herepactkaging.com, www.herepatkaging.com, www.herepacvkaging.com, www.herepavkaging.com, www.herepacfkaging.com, www.herepafkaging.com, www.herepacgkaging.com, www.herepagkaging.com, www.herepachkaging.com, www.herepahkaging.com, www.herepacnkaging.com, www.herepankaging.com, www.herepacmkaging.com, www.herepamkaging.com, www.herepacjkaging.com, www.herepajkaging.com, www.herepacaging.com, www.herepacktaging.com, www.herepactaging.com, www.herepackaging.com, www.herepacaging.com, www.herepackgaging.com, www.herepacgaging.com, www.herepackbaging.com, www.herepacbaging.com, www.herepacknaging.com, www.herepacnaging.com, www.herepackhaging.com, www.herepachaging.com, www.herepackyaging.com, www.herepacyaging.com, www.herepacklaging.com, www.herepaclaging.com, www.herepackoaging.com, www.herepacoaging.com, www.herepackuaging.com, www.herepacuaging.com, www.herepackiaging.com, www.herepaciaging.com, www.herepackmaging.com, www.herepacmaging.com, www.herepackging.com, www.herepackaoging.com, www.herepackoging.com, www.herepackapging.com, www.herepackpging.com, www.herepacka9ging.com, www.herepack9ging.com, www.herepackaging.com, www.herepackging.com, www.herepackaiging.com, www.herepackiging.com, www.herepackauging.com, www.herepackuging.com, www.herepackaing.com, www.herepackagsing.com, www.herepackasing.com, www.herepackagxing.com, www.herepackaxing.com, www.herepackagying.com, www.herepackaying.com, www.herepackaghing.com, www.herepackahing.com, www.herepackagning.com, www.herepackaning.com, www.herepackagcing.com, www.herepackacing.com, www.herepackagding.com, www.herepackading.com, www.herepackageing.com, www.herepackaeing.com, www.herepackagring.com, www.herepackaring.com, www.herepackagting.com, www.herepackating.com, www.herepackagbing.com, www.herepackabing.com, www.herepackagving.com, www.herepackaving.com,

Other websites we recently analyzed

  1. chefs2you.com
    United States - 192.195.77.236
    Server software: Apache
    Technology: Html
    Number of meta tags: 1
  2. Overseesjob
    United Kingdom - 95.215.224.23
    Server software: Microsoft-IIS/7.5
    Technology: BootstrapCDN, CSS, Font Awesome, Html, Javascript, jQuery, SVG
    Number of Javascript: 169
    Number of meta tags: 1
  3. federalcriminalappealslawyers.com
    Scottsdale (United States) - 50.63.202.60
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  4. sanvini.nl
    sanvini.nl
    Netherlands - 62.148.163.233
    Server software: Apache
    Technology: CSS, Html, Html5
    Number of Javascript: 1
    Number of meta tags: 6
  5. Spółdzielnia Mieszkaniowa w Jarosławiu
    Jaroslaw (Poland) - 185.25.120.34
    Server software:
    Technology: BootstrapCDN, CSS, Flexslider, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, jQuery UI, Lightbox, Php, Pingback, Wordpress
    Number of Javascript: 44
    Number of meta tags: 4
  6. eternal-promi.se.net
    San Jose (United States) - 205.164.14.88
    Server software: Tengine/1.4.2
    Technology: Google Adsense, Html, Javascript, Php
    Number of Javascript: 2
    Number of meta tags: 1
  7. 508 Espacio Pop Up · Valencia | Diseño, Moda, Eventos, Talleres
    Espacio en el centro de Valencia donde damos cabida a diseñadores, exposiciones, tiendas... Un lugar efímero lleno de creatividad y nuevas experiencias.
    France - 5.135.78.248
    Server software: nginx
    Technology: CSS, Flexslider, Font Awesome, Google Font API, Gravatar, Html, Html5, Iframe, Javascript, jQuery, Php, Pingback, Revslider, Shortcodes, WordPress Stats, Wordpress
    Number of Javascript: 37
    Number of meta tags: 5
  8. My Blog – My WordPress Blog
    Austin (United States) - 198.54.116.10
    Server software: Apache
    Technology: CSS, Google Font API, Gravatar, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
    Number of Javascript: 5
    Number of meta tags: 3
  9. armorygp.com
    United States - 208.91.197.27
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  10. Kaplan Investment / Eda Konutları Antalya
    We provide free flash templates, free templates, free flash header
    Ankara (Turkey) - 217.116.199.188
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Javascript
    Number of Javascript: 7
    Number of meta tags: 2

Check Other Websites